Web Analysis for Watchintenselyspeedythefile - watchintenselyspeedythefile.vip
watchintenselyspeedythefile.vip is 2 years 9 months old. It is a domain having vip extension. It has a global traffic rank of #3830141 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, watchintenselyspeedythefile.vip is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | 220 |
Daily Pageviews: | 440 |
Estimated Valuation
Income Per Day: | $ 1.00 |
Estimated Worth: | $ 240.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | 3,830,141 |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 18.215.40.75)
HTTP Header Analysis
Date: Fri, 30 Jul 2021 21:33:31 GMT
Content-Type: text/html
Content-Length: 552
Connection: keep-alive
Server: nginx
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
dns1.registrar-servers.com | 156.154.132.200 | United States of America | |
dns2.registrar-servers.com | 156.154.133.200 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
watchintenselyspeedythefile.vip | A | 60 |
IP: 18.215.40.75 |
watchintenselyspeedythefile.vip | NS | 1800 |
Target: dns1.registrar-servers.com |
watchintenselyspeedythefile.vip | NS | 1800 |
Target: dns2.registrar-servers.com |
watchintenselyspeedythefile.vip | SOA | 3601 |
MNAME: dns1.registrar-servers.com RNAME: hostmaster.registrar-servers.com Serial: 1627553538 Refresh: 43200 Retry: 3600 Expire: 604800 Minimum TTL: 3601 |
watchintenselyspeedythefile.vip | MX | 1800 |
Priority: 20 Target: eforward5.registrar-servers.com |
watchintenselyspeedythefile.vip | MX | 1800 |
Priority: 15 Target: eforward4.registrar-servers.com |
watchintenselyspeedythefile.vip | MX | 1800 |
Priority: 10 Target: eforward1.registrar-servers.com |
watchintenselyspeedythefile.vip | MX | 1800 |
Priority: 10 Target: eforward2.registrar-servers.com |
watchintenselyspeedythefile.vip | MX | 1800 |
Priority: 10 Target: eforward3.registrar-servers.com |
watchintenselyspeedythefile.vip | TXT | 1800 |
TXT: v=spf1 include:spf.efwd.registrar-servers.com ~all |
Similarly Ranked Websites
Busty Galleries : 1000`s of Free Big tits, BBW, Mature, Ebony, Fat and
Busty Galleries Is Free Movie Site with fresh big tits, bbw, fat, mature, ebony and pregnant movie XXX galleries, daily updated
The Tile & Stone Specialist | Lapicida
Lapicida is the leading specialist in luxury surfaces, supplying new and antique natural stone alongside ceramics, porcelains, quartz and manmade ‘sintered’ stone. Based in Yorkshire, we work with architects, interior designers, retailers and trade customers across the UK, Europe and the US.
Sigma – Machinery for the Chemical, Soap, Cosmetic , and Pharmaceutica
Weight Lose Quick
View the latest health news and explore articles on fitness, diet, nutrition, parenting, Weight loss,relationships, Cancer signs, medicine, diseases, and healthy living at weightlosequick.com Health.
Miniature Microphone Specialists Stereo - Mono - Cardioid - Omnidrecti
Giant Squid Audio Lab offers a selection of high fidelity Binaural / Stereo and Mono analog and digitalaudio hardware for the pro and amateur, digital and analog audio community and discriminatingmusicians, as well as analog / digital audio patch cables. We specialize in our own make and model ofsmall, durable high fid
Full WHOIS Lookup
Registry Domain ID: D_0228CB96_64EA03D761F74DECA82E5784476D0E32_0000017AF1C0046D-VIP
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 0001-01-01T00:00:00.00Z
Creation Date: 2021-07-29T10:12:10.98Z
Registrar Registration Expiration Date: 2022-07-29T10:12:10.98Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID:
Registrant Name: Withheld for Privacy Purposes
Registrant Organization: Privacy service provided by Withheld for Privacy ehf
Registrant Street: Kalkofnsvegur 2
Registrant City: Reykjavik
Registrant State/Province: Capital Region
Registrant Postal Code: 101
Registrant Country: IS
Registrant Phone: +354.4212434
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: cb588cff6cff462da7a57de1793f2fc0.protect@withheldforprivacy.com
Registry Admin ID:
Admin Name: Withheld for Privacy Purposes
Admin Organization: Privacy service provided by Withheld for Privacy ehf
Admin Street: Kalkofnsvegur 2
Admin City: Reykjavik
Admin State/Province: Capital Region
Admin Postal Code: 101
Admin Country: IS
Admin Phone: +354.4212434
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: cb588cff6cff462da7a57de1793f2fc0.protect@withheldforprivacy.com
Registry Tech ID:
Tech Name: Withheld for Privacy Purposes
Tech Organization: Privacy service provided by Withheld for Privacy ehf
Tech Street: Kalkofnsvegur 2
Tech City: Reykjavik
Tech State/Province: Capital Region
Tech Postal Code: 101
Tech Country: IS
Tech Phone: +354.4212434
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: cb588cff6cff462da7a57de1793f2fc0.protect@withheldforprivacy.com
Name Server: dns1.registrar-servers.com
Name Server: dns2.registrar-servers.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-07-30T16:33:35.84Z <<<
For more information on Whois status codes, please visit https://icann.org/epp